Protein Info for ABID97_RS16785 in Variovorax sp. OAS795

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 799 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 261 to 280 (20 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details amino acids 360 to 377 (18 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details amino acids 435 to 453 (19 residues), see Phobius details amino acids 656 to 674 (19 residues), see Phobius details amino acids 681 to 702 (22 residues), see Phobius details amino acids 708 to 728 (21 residues), see Phobius details amino acids 741 to 761 (21 residues), see Phobius details amino acids 772 to 789 (18 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_2674)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (799 amino acids)

>ABID97_RS16785 transporter (Variovorax sp. OAS795)
MSARQSGGGLPSWRRRAVVLLVWALVLLGGGLQIARTHFSADLSAFLPKSPDVRQQVLIE
QLQSGVASRTLMLGIEGGADVEQRAAVSRAVAKSMRESKLFDLIQNGDTGDWSEAGTWVF
AHRYQLSPGVKPDHFTVDGLRDAIYETLSMLGTPAGNAIKPLLDRDPTGETQRIAVELTP
ASAPRSENGVWMSRTAPRALMIATTRAAGSDLDAQAVAIARVQAAFDAATQGMAEAARPK
LLLSGPPVFSVLSRDKIKTEAMHLAIVGGFVMGGLLLLAFASPRALVIAFLPVATGVVVG
TAAVSVVFGSVHGMTLGFGSTLIGETVDYAIYYLIQARGAAVAGTGWARWRDVHWPTVRL
GLLTSVCGFAALLFSGFPGLAQLGVFSIAGLVAAALATRYALPVLAPDGATGMGMRRYMA
NAAGVLVRGLPRLRWVLAGLGVAALALVIWQGGHLWRADLGAMSPVPKSAQQLDEMLRAD
IGTGDGSTLVVVYGADEETALRNTEAATARLEALVDKGELGGFEAVTRVLPSVATQAARL
ASLPEAEALRMRLAEATQGSPLPATRLGPFLADVEAARKLAPVRRADLTGGPLGSVVNTL
MYQRPGGGWSTLVVLHPGPNFNAGRLEQALAGVPEVQVVDVGRELAGLYQRYLHEAFVQV
MLGALAVVVLLGIYLRSGKRLLAVCQPLVVAVVLTLGGMAVLQVPLGILHLVGLLLIVAV
GSNYALFFDQLRVSGRADEDTLASLMLANLTTVVSFGLIAISDIPALSSIGRVVAPGALL
ALLLSAAFARRVTPPPARG