Protein Info for ABID97_RS16745 in Variovorax sp. OAS795

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF01209: Ubie_methyltran" amino acids 35 to 246 (212 residues), 106.8 bits, see alignment E=3.9e-34 PF13489: Methyltransf_23" amino acids 71 to 187 (117 residues), 49.2 bits, see alignment E=1.8e-16 PF13847: Methyltransf_31" amino acids 73 to 174 (102 residues), 33.8 bits, see alignment E=1e-11 PF13649: Methyltransf_25" amino acids 77 to 166 (90 residues), 60.4 bits, see alignment E=8.1e-20 PF08242: Methyltransf_12" amino acids 78 to 168 (91 residues), 41.3 bits, see alignment E=7.8e-14 PF08241: Methyltransf_11" amino acids 78 to 170 (93 residues), 66.4 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 92% identity to vap:Vapar_2682)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.163

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>ABID97_RS16745 class I SAM-dependent methyltransferase (Variovorax sp. OAS795)
MTPSPSVGPGKPTILPPHTPLPLYYKNETEHQAFLRRIFDSTAADYDRIESVLAFGTGPS
YRRAALTQAGLAQGAQVLDVGIGTGLVAREALKIIGPRGQLVGVDPSVGMMEQIDLPGVE
LVTGVAEALPRPDASCDFVSMGYAMRHISDVAAAFSEFHRVLRPGGRLVVLEITKPNGRV
ATAMLKGYMRAVVPLIARVVGRRTNTSELWRYYWDTIEACIPPERVLEALRAAGFSDVRR
RASLGVFSEYMARKPETTAKAG