Protein Info for ABID97_RS16670 in Variovorax sp. OAS795

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 209 to 224 (16 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 284 to 301 (18 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 15 to 321 (307 residues), 74.1 bits, see alignment E=5.7e-25

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>ABID97_RS16670 acyltransferase (Variovorax sp. OAS795)
MKYLSDFDGVRANNFTALRLLFAWLVLFGHSYLIANPSVYDPVSAYLVPYAWLGSIAVSG
FFVISGFLVTASFIQRGPVNFVASRALRLYPCVIVYSLLMIFVLGPMAKSVDFSTYWKAE
PWNNMWNSLLWSWQYNLPYVFVDNPFKGSTNSSTWTLPVELRCYIGILFLGLAGTLKENR
TANFALLLLLFAVVWNFDVLPFFNETYRVADPLLFFIMGSLAWINRQHIPLNGPLALVAL
IMPFLLATTDFYEPVYVTCFSYVIFYAAYRLPHVNVDRFGDISYGLYIYAWPIQQLVWYP
GQGGLRNAVYATAITVPLAYLSWRLIEKPALGLRQLLAGRRPSRNAQGQPAPATGPIQAS
GEKPVVVAGVARG