Protein Info for ABID97_RS16625 in Variovorax sp. OAS795

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 42 to 66 (25 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 209 (195 residues), 120 bits, see alignment E=4.7e-39

Best Hits

KEGG orthology group: None (inferred from 79% identity to vap:Vapar_2721)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>ABID97_RS16625 LysE family translocator (Variovorax sp. OAS795)
MTLATALLFSIVALAAIATPGPTVLLALSNGSRRGVRGALPGILGAVLSDFVLVGAVALG
LGALLAASEFWFSMLKWVGAVYLAWLGIRMLRSRGGSFDAPRAAAGEPGTGTNGDGRKVF
LKSFLVAVTNPKGYLFCSALMPQFIDPAAAQGMQYAIISVLFASLDASVMLVYAFVGARA
MRLLTAAAGRWIDRTCGAMLLALAGSLAFYRRSGT