Protein Info for ABID97_RS16595 in Variovorax sp. OAS795

Annotation: CbiX/SirB N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF01903: CbiX" amino acids 14 to 118 (105 residues), 93.7 bits, see alignment E=4e-31

Best Hits

KEGG orthology group: K03795, sirohydrochlorin cobaltochelatase [EC: 4.99.1.3] (inferred from 87% identity to vap:Vapar_2727)

Predicted SEED Role

"Sirohydrochlorin cobaltochelatase (EC 4.99.1.3)" in subsystem Coenzyme B12 biosynthesis or Experimental tye (EC 4.99.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (124 amino acids)

>ABID97_RS16595 CbiX/SirB N-terminal domain-containing protein (Variovorax sp. OAS795)
MAADKARGIILLAHGSRDERWRAPIEAVAARVTALDPQARVVCAYMELAAPDLRTAAAAL
IASGARALRIVPLFLGMGKHAREDLPLQVDALRGNWPDVEIQLANIVGEEPELVELLARI
ATKS