Protein Info for ABID97_RS16465 in Variovorax sp. OAS795

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details PF00892: EamA" amino acids 10 to 142 (133 residues), 57.8 bits, see alignment E=6.7e-20 amino acids 157 to 287 (131 residues), 35.7 bits, see alignment E=4.6e-13

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_2752)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ABID97_RS16465 DMT family transporter (Variovorax sp. OAS795)
MLLRLTHGGAVWLMVAVTLMWATAGVVTRHLEQANSFEITFWRSLFTMVALLVILPLWRG
RAVFSQIRSGGRELWISGVCWTVMFTAFMVALTLASTASVLVTMSLGPLLTALAARLFIG
HRLPARTWLAIVVAGLGIAWMYGTQLMQGGPAGGSLIGTLVALCVPLAGATNWTVVQHAQ
AKGRNIDLVPAVLIGAALSTLATLPFALPFKATPHDLGLLAFLGVFQLAIPCVLSVLCAR
VLKAPEVALLALLEVIFGIALAWLGAGEEPAASVLTGGVLVIGALVFNELLAMRGRRAAV
SDGVLPGAH