Protein Info for ABID97_RS16260 in Variovorax sp. OAS795

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 118 to 133 (16 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details TIGR00858: 8-amino-7-oxononanoate synthase" amino acids 24 to 398 (375 residues), 432.3 bits, see alignment E=6e-134 PF00155: Aminotran_1_2" amino acids 47 to 397 (351 residues), 181.7 bits, see alignment E=1.3e-57

Best Hits

Swiss-Prot: 66% identical to BIOF_CUPNJ: 8-amino-7-oxononanoate synthase (bioF) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 94% identity to vap:Vapar_2811)

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>ABID97_RS16260 8-amino-7-oxononanoate synthase (Variovorax sp. OAS795)
MSRLLDRLEDEIGALDAKSLRRRRQIAESACAPEQSLTLAGAGAPRTMLGFSSNDYLGLA
AHPALAAALAEGAARYGTGSGGSHLILGHSRAHAELEERLAGWMAPHIPEARSLFFCTGY
MANLAVLSALGGAEAVIFSESLNHASLIDGARLAKARVERYLHCDVAALDAQLGACDAPV
KLIVSDAVFSMDGNIAPVAELLALAERHDAWLVLDDAHGFGVLGATGRGVLQAMGLCSER
LVLIGTLGKAAGVSGAFVAAHRTVIDYLVQRARPYIFTTAAPPAIAHALLASLALIEGEE
GGIRRARLQARIGQLRRGLGAILPPDGSAWLPDSPTAIQPLIVGDNARAMQAMARLDAHG
LRVGAIRPPTVPAGTARLRITLSASHSEADVARLLDAMGDALAVRG