Protein Info for ABID97_RS16205 in Variovorax sp. OAS795

Annotation: cytochrome c oxidase accessory protein CcoG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 52 to 71 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 211 to 227 (17 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 50 to 483 (434 residues), 505.8 bits, see alignment E=5.3e-156 PF12801: Fer4_5" amino acids 106 to 146 (41 residues), 41.1 bits, see alignment 6.4e-14 PF13746: Fer4_18" amino acids 228 to 333 (106 residues), 140.6 bits, see alignment E=1.1e-44 PF00037: Fer4" amino acids 280 to 294 (15 residues), 22.7 bits, see alignment (E = 3e-08) PF11614: FixG_C" amino acids 369 to 485 (117 residues), 107.7 bits, see alignment E=1.9e-34

Best Hits

KEGG orthology group: None (inferred from 89% identity to vap:Vapar_2822)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>ABID97_RS16205 cytochrome c oxidase accessory protein CcoG (Variovorax sp. OAS795)
MDSSAPVSAPAPVDRPGARKVIPIASADGDAQGLYEATKKIYPRTVRGMFARWRWAMVFL
TQLVFYGLPWAEWGERQLVLFDLAARRFYIFGLVLYPQDLIYLSGLLVVSALALFLFTAV
AGRLWCGYACPQTVYTEIFMWVEHKIEGNRTARMRLDTEPMSLEKLVKKWFKHLVWIGIA
LWTGFTFVGYFTPIRDLGLAFLQTRMGSWEVFWVFFYGFATYGNAGFMREQVCKYMCPYA
RFQSAMFDRDTLIVTYDPKRGEPRAPRRKGPDPRSMALGDCIDCGLCVQVCPTGIDIREG
LQYECIGCGLCVDACDTVMQKMAYAPRLIRYDTQNGMEAGWTRRQLLRRVLRPRVLVYSA
ILALLVAGLLASLVARTPLKVDVVRDRASLARIVEGGLLENVYRLQVMNATEEARHYRIA
AHGIEGLRVSPDERITVDAAQSRWVAVRLQVPYGVVPAGSHAVHFDIRDEDSGVRVSEKA
VFLVPR