Protein Info for ABID97_RS16040 in Variovorax sp. OAS795

Annotation: protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 553 to 574 (22 residues), see Phobius details PF13672: PP2C_2" amino acids 17 to 197 (181 residues), 45 bits, see alignment E=2e-15 PF07228: SpoIIE" amino acids 76 to 236 (161 residues), 27.2 bits, see alignment E=6.9e-10 PF00069: Pkinase" amino acids 283 to 523 (241 residues), 127.7 bits, see alignment E=1.1e-40 PF07714: PK_Tyr_Ser-Thr" amino acids 287 to 522 (236 residues), 75.3 bits, see alignment E=9.8e-25

Best Hits

KEGG orthology group: None (inferred from 89% identity to vap:Vapar_2845)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>ABID97_RS16040 protein kinase (Variovorax sp. OAS795)
MHSGLAISIGQHSDKGRKDANQDFHGAALPEAAARHAKGVAIAIADGISSSDVSHVASES
AVRSFLTDYYCTSDAWSVSRSAQRVLTATNAWLHAQTQGGRGRFDKDRGYVCTFSALVLK
STTAHVFHVGDTRVIRWHADALEPLTEDHRVLVADGHSYLSRALGVGPHVEIDYQAVAIE
KGDVFLLTSDGVHEHVDAAAIGAALADHPHDLDAAARRIAEEAFRRGSPDNLTVQVVRID
ALPDGEFNELQAQRAALQLPPVLEARMRFDGYTIVRDLHRSHRSHIYLAVDDETGQRVVL
KTPSIDLQNDEAHLDRFLLEEWVARRIASAHVLKPHVPDRKRNYLYVAMEFVDGQTLAQW
MVDNPRPSLESVRRIVEQLAKGLQAFHRMEMLHQDLRPENVMIDRTGTVRIIDFGSAWVA
GLGEGARAEPDAILGTVQYTAPEYFLGDGGSARSDLFSLAVIVYQMLTGRLPYGAEAARI
RTRADQRNLQYRSALDAQRAIPAWIDEVLRKALHPNPQKRHEALSEFVQDLRQPHPDFLS
RRGTPLVEKNPVVFWKCATLVLGIALVVLLGVMSLRG