Protein Info for ABID97_RS16015 in Variovorax sp. OAS795

Annotation: secondary thiamine-phosphate synthase enzyme YjbQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR00149: secondary thiamine-phosphate synthase enzyme" amino acids 14 to 139 (126 residues), 141.4 bits, see alignment E=7.1e-46 PF01894: UPF0047" amino acids 20 to 136 (117 residues), 141 bits, see alignment E=9.7e-46

Best Hits

Swiss-Prot: 50% identical to Y1880_SYNY3: UPF0047 protein sll1880 (sll1880) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 84% identity to vap:Vapar_2851)

Predicted SEED Role

"Uncharacterized protein sll1880 (YjbQ family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>ABID97_RS16015 secondary thiamine-phosphate synthase enzyme YjbQ (Variovorax sp. OAS795)
MLSQATTTLDFDTAGRGLLDITAAVERWVQGTGRRNGLLTLFIRHTSASLLVQENADPEV
QADLERFFARLVPDGDPLFRHRDEGPDDMPAHVRAALTAVQLSIPVIDGRMVLGTWQGIY
LWEHRKRPHRRQVVLHLIGL