Protein Info for ABID97_RS16005 in Variovorax sp. OAS795

Annotation: ankyrin repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12796: Ank_2" amino acids 29 to 115 (87 residues), 45.9 bits, see alignment E=1.8e-15 amino acids 71 to 150 (80 residues), 61.1 bits, see alignment E=3.2e-20 amino acids 148 to 208 (61 residues), 42.7 bits, see alignment E=1.7e-14 PF00023: Ank" amino acids 92 to 119 (28 residues), 21.8 bits, see alignment (E = 4.6e-08) amino acids 121 to 150 (30 residues), 28.4 bits, see alignment 3.5e-10 amino acids 153 to 184 (32 residues), 30.8 bits, see alignment 6.2e-11 PF13637: Ank_4" amino acids 97 to 141 (45 residues), 30.1 bits, see alignment 1.1e-10 amino acids 125 to 174 (50 residues), 42.3 bits, see alignment E=1.7e-14 amino acids 158 to 205 (48 residues), 27.4 bits, see alignment 8.4e-10 PF13606: Ank_3" amino acids 121 to 143 (23 residues), 25.2 bits, see alignment (E = 3.5e-09) amino acids 156 to 179 (24 residues), 20.9 bits, see alignment (E = 9.2e-08) PF13857: Ank_5" amino acids 150 to 194 (45 residues), 29.2 bits, see alignment 2.5e-10

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 92% identity to vap:Vapar_2854)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>ABID97_RS16005 ankyrin repeat domain-containing protein (Variovorax sp. OAS795)
MNNYMKKFLYLIAAAATFSAHAGSFEDFFRAVRADNASGVRTLLNRGFDPNTRDEHGQTG
LIIALREPSPKVAQVLIESPQTDVDIANAKDETPLMLAAIKGQQDVVTQLLKRDAAVNKT
GWTPLHYAASSGQLSIMKVLLDKFAFIDAQSPNGTTPLMMAAMYGSTEAVKLLLAEGADT
AMKNQLGMTAVDFATKANRPEAAQLIAASTDAKAGPKPVPKDGKW