Protein Info for ABID97_RS15965 in Variovorax sp. OAS795

Annotation: YbgC/FadM family acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 17 to 128 (112 residues), 86.1 bits, see alignment E=1.1e-28 PF13279: 4HBT_2" amino acids 20 to 138 (119 residues), 47.4 bits, see alignment E=6.5e-16 PF03061: 4HBT" amino acids 29 to 112 (84 residues), 46.8 bits, see alignment E=7.5e-16 PF00583: Acetyltransf_1" amino acids 182 to 270 (89 residues), 37.7 bits, see alignment E=5.6e-13 PF13508: Acetyltransf_7" amino acids 195 to 271 (77 residues), 38.5 bits, see alignment E=3.1e-13 PF13673: Acetyltransf_10" amino acids 213 to 289 (77 residues), 57.7 bits, see alignment E=3.1e-19

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_2862)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABID97_RS15965 YbgC/FadM family acyl-CoA thioesterase (Variovorax sp. OAS795)
MTEETIPRRKDFRFFHRLRVRWAEVDMQKIVFNAHYLMYFDTAIADYWRALALPYEEAMH
ALGGDLYVRKATVDFRASARMDDVIDVAMKCARIGNSSMVFEGALFRQDQYLVGCELVYV
FADPATQTSKPVPPLLREILTGFEAGEPMRTVETGDWKTLGEGASALRRAVFIEEQNIPK
ELEWDAHDEVVLHAVACNRLGQAIATGRLLNAVDGTAMLGRMAVHRALRSGGHGAAIMQA
LEAAAKARGDREIGLHAQRSAERFYARLGYKVHGEPFDEAGIPHIEMRRALDQ