Protein Info for ABID97_RS15880 in Variovorax sp. OAS795

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 61 to 82 (22 residues), see Phobius details amino acids 85 to 87 (3 residues), see Phobius details amino acids 101 to 103 (3 residues), see Phobius details amino acids 107 to 135 (29 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details PF04403: PqiA" amino acids 58 to 213 (156 residues), 167.8 bits, see alignment E=8.9e-54

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 90% identity to vap:Vapar_2894)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>ABID97_RS15880 paraquat-inducible protein A (Variovorax sp. OAS795)
MGPLLPAEGDEDEAPVATAASLGLLACPHCDAVWRDAQEGEPCGRCGTHLYTRKPYSLSR
TWAFLIAACIMYIPANLLPVMITRTLFGAQYDTILSGVIYFWVSGAYGLAAIIFIASFLV
PLFKLTVLILLALLAQRASRWRRPERARLYHIIEIIGRWSMLDVFVVSLLTGLVQIQGFA
VINAGVGIAAFGSVVVLTMLASLSFDPRLTWDSRQEQEAEGESKREQQPHGNREEKPA