Protein Info for ABID97_RS15775 in Variovorax sp. OAS795

Annotation: NADP-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF16884: ADH_N_2" amino acids 5 to 108 (104 residues), 134.4 bits, see alignment E=2.1e-43 PF00107: ADH_zinc_N" amino acids 160 to 294 (135 residues), 64.1 bits, see alignment E=1.9e-21 PF13602: ADH_zinc_N_2" amino acids 193 to 333 (141 residues), 34.8 bits, see alignment E=4.4e-12

Best Hits

Swiss-Prot: 41% identical to YKM8_SCHPO: Zinc-type alcohol dehydrogenase-like protein PB24D3.08c (SPAPB24D3.08c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K07119, (no description) (inferred from 96% identity to vap:Vapar_2917)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>ABID97_RS15775 NADP-dependent oxidoreductase (Variovorax sp. OAS795)
MPTNKQIHLDNRPEGEAVAGNFKLVTAETPALADNQVLVRHHFMSLDPYMRGRMNDSKSY
AQPQPLGQVMQGGTAGEVVESRHPRFAAGDKVVGFGGWQEYSVVDASQPGALKKVDTTHV
PLSHYLGAVGMPGVTAWYGLVKIIAPKAGETMVVTAASGAVGSAFGALAKARGCRVVGIA
GGPDKCKYVTDELGFDACIDYRQHPDVKSMSAALKEACPNGIDGYFENVGGYIFDAVLLR
ANAFSRVALCGMIAGYDGQPLALANPALILINRMKIEGFIVSEHMDVWPEALAELGALVG
TGKLKPRESVAQGIEAAPEAFLGLLKGKNFGKQLVKLV