Protein Info for ABID97_RS15640 in Variovorax sp. OAS795

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 72 to 88 (17 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details PF07681: DoxX" amino acids 9 to 88 (80 residues), 76 bits, see alignment E=1.5e-25

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_2947)

Predicted SEED Role

"DoxX family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>ABID97_RS15640 DoxX family protein (Variovorax sp. OAS795)
MTKSDDTGKLVLRVALGILILLHGIAKVGKGVDGIGGMLASHGLPAATAYLVYVGEILAP
VLLIVGLFTRPAALIIAINMVVAIWLAHFKDLGALNSQGGWALELQGMYLFAALAISLFG
GGRFGLGGRYN