Protein Info for ABID97_RS15635 in Variovorax sp. OAS795

Annotation: peptide deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01327: Pep_deformylase
  • amino acids 3 to 160 (158 residues), 156 bits, E=3e-50
• TIGR00079: peptide deformylase
  • amino acids 4 to 159 (156 residues), 113.7 bits, E=3e-37

Best Hits

Swiss-Prot: 70% identical to DEF2_BORPA: Peptide deformylase 2 (def2) from Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 96% identity to vap:Vapar_2948)

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.88

Use Curated BLAST to search for 3.5.1.88

Protein Sequence (179 amino acids)

>ABID97_RS15635 peptide deformylase (Variovorax sp. OAS795)
MAIREILKMGDPRLLRVAQPVAAFDTDELHLLVRDMFETMHAVNGAGLAAPQIGVDQQLV
IFGTDVVNPRYPDAPPVPRTVLLNPVITPLGDEEEEGWEGCLSVPGLRGVVPRFANIRYT
GFDPYGDPIDRMASGFHARVVQHEVDHLLGKLYPMRVRDFSRFGYTEVLFPGLDANEDD