Protein Info for ABID97_RS15580 in Variovorax sp. OAS795

Annotation: sulfate ABC transporter permease subunit CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 68 to 94 (27 residues), see Phobius details amino acids 107 to 133 (27 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 19 to 278 (260 residues), 338.5 bits, see alignment E=3.1e-105 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 21 to 280 (260 residues), 429.2 bits, see alignment E=5.8e-133 PF00528: BPD_transp_1" amino acids 85 to 272 (188 residues), 45.5 bits, see alignment E=3.7e-16

Best Hits

Swiss-Prot: 52% identical to CYSW_ECOLI: Sulfate transport system permease protein CysW (cysW) from Escherichia coli (strain K12)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 95% identity to vpe:Varpa_2697)

MetaCyc: 52% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>ABID97_RS15580 sulfate ABC transporter permease subunit CysW (Variovorax sp. OAS795)
MSAPSKVIRRAQAGTTESPWVRWSLIGVALAFMFLFLVLPLAAVATEALRKGVGAYLEAL
QEPDAWSAIRLTLITAAIAVPLNLVFGVAAAWAIAKFEFRGKAFLTTLVDLPFAVSPVVA
GLIYVLVFGAQGWFGPWLAAHDIKIIFAVPGIVLATVFVTFPFIARELVPLMQAQGTDEE
QAAIVLGATGWQTFWRVTLPNIKWGLLYGVILCNARAMGEFGAVSVVSGHIRGQTNTMPL
HVEVLYNEYQSVAAFAVASLLAILALVTLVIKSVIEWRHEREMKAIAELPPERPTQA