Protein Info for ABID97_RS15575 in Variovorax sp. OAS795

Annotation: sulfate ABC transporter permease subunit CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 27 to 287 (261 residues), 326 bits, see alignment E=2e-101 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 28 to 291 (264 residues), 418.8 bits, see alignment E=9.7e-130 PF00528: BPD_transp_1" amino acids 94 to 292 (199 residues), 83.9 bits, see alignment E=6.3e-28

Best Hits

Swiss-Prot: 52% identical to CYST_SALTY: Sulfate transport system permease protein CysT (cysU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 96% identity to vap:Vapar_2960)

MetaCyc: 51% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>ABID97_RS15575 sulfate ABC transporter permease subunit CysT (Variovorax sp. OAS795)
MSGAVSSALPSAGAPLSHVNRAGGARRVLPGFHITLGFSIFYLCLIVLIPLSALVFKTFT
LSWEQFWVAVTAPRVMASYRLTFGASLIAALVNTVFGLLVAWVLVRYRFPGKRIVDALVD
LPFALPTAVAGISLTALLAGNGWIGRLLEPHGIKLAFTPAGIVIALIFIGLPFVVRTVQP
VLEDAEKELEEAATSLGATRLQTFTKVIFPSIAPALFTGFAMAFARAIGEYGSVIFIAGN
MPMISEITPLIIIGKLEQYDFAGATAVALVMLVISFVLLLVINGLQAWQRRRAGA