Protein Info for ABID97_RS15530 in Variovorax sp. OAS795

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 229 to 250 (22 residues), see Phobius details amino acids 310 to 325 (16 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details PF01494: FAD_binding_3" amino acids 21 to 340 (320 residues), 77.4 bits, see alignment E=4.6e-25 PF04820: Trp_halogenase" amino acids 22 to 106 (85 residues), 40.8 bits, see alignment E=4.7e-14 amino acids 111 to 368 (258 residues), 56.9 bits, see alignment E=6.4e-19 PF12831: FAD_oxidored" amino acids 22 to 184 (163 residues), 30.5 bits, see alignment E=8.7e-11 PF05834: Lycopene_cycl" amino acids 22 to 179 (158 residues), 24.9 bits, see alignment E=3.8e-09 PF00890: FAD_binding_2" amino acids 22 to 56 (35 residues), 20.5 bits, see alignment 8.6e-08 PF13450: NAD_binding_8" amino acids 25 to 58 (34 residues), 30.1 bits, see alignment 1.7e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_2969)

Predicted SEED Role

"FIG022199: FAD-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>ABID97_RS15530 NAD(P)/FAD-dependent oxidoreductase (Variovorax sp. OAS795)
MSLPQAVSSAPSMPPATEESCDVLVIGGGPAGSTISALLAQQGRQVVLLEKAHHPRFHIG
ESLLPANVELFEKLGVRDQVEKIGMPKFGIEFVSPEHEHRSYVDFSEGWDKALDSAWQVR
RSDLDELLFRNAATRGAQTIEGCKVRDVAFDADGATVQAEMDDGARRSWRARFVVDATGR
DTLLANKFRCKEKNPDHNSTALFGHFTNAERLEGKKEGNISICWFPHGWFWFIPLADGTT
SVGAVCWPYYLKTRDKPLKDFFYDTIGLCPVLVERLRNATLVDDAVHATGNFSYSSTHAT
GDRYLMLGDAFTFIDPMFSSGVYLAMHSAFDGAQLVATALDKPAELAPARKDFEAMMRKG
PREYSWFIYRVTNPTIRDMFMHPGNPFRVKEGLMSLLAGDIYRGTPMWRALGMFKFLYYF
ISITHMRRTWEGWKRHRFNVRDMGALKGETILKSD