Protein Info for ABID97_RS15480 in Variovorax sp. OAS795

Annotation: sulfonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 35 to 311 (277 residues), 214.3 bits, see alignment E=1.1e-67 PF13379: NMT1_2" amino acids 58 to 196 (139 residues), 28.3 bits, see alignment E=2.4e-10 PF04069: OpuAC" amino acids 59 to 229 (171 residues), 24.2 bits, see alignment E=3.5e-09 PF09084: NMT1" amino acids 67 to 205 (139 residues), 53.5 bits, see alignment E=4.6e-18

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 92% identity to vap:Vapar_2978)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>ABID97_RS15480 sulfonate ABC transporter substrate-binding protein (Variovorax sp. OAS795)
MTSISIPRRRLLQGTAAALALPSFAALAQAQGRQLRIGHQKGALSILKGRGTLEKRLAPL
GVSVKWTEFTAGPVQLEALNVGSIDFGDVGEAPPIFAQAAGAPLAYVATTLPRPQSEAVL
VPKGSAIRSVADLKGKKIALNKGSNVHYFIVKLAEKHGLAYSDLNLVYLPPSDARAAFEK
GSVDAWVIWDPFLAAAEKLLEARILADATGVVGNRGYYFSSLGFVAKNADVLAIAIEEIN
KVDVWGTAHKSELAAEFATLWGLPKPVADLTVARAAYGTSPISKAVLAEQQKIADTFFEL
KLIPRKINVFEAAAAGIA