Protein Info for ABID97_RS15470 in Variovorax sp. OAS795

Annotation: NADPH-dependent FMN reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02525: Flavodoxin_2
  • amino acids 1 to 126 (126 residues), 39.4 bits, E=5.6e-14
• PF03358: FMN_red
  • amino acids 1 to 142 (142 residues), 112.4 bits, E=1.6e-36
• TIGR03567: FMN reductase
  • amino acids 3 to 170 (168 residues), 231.1 bits, E=3.8e-73

Best Hits

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 91% identity to vpe:Varpa_2668)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

• two-component alkanesulfonate monooxygenase (2/2 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (2/3 steps found)
• bacterial bioluminescence (4/8 steps found)
• dibenzothiophene desulfurization (1/5 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (21/33 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.29

Use Curated BLAST to search for 1.5.1.29

Protein Sequence (194 amino acids)

>ABID97_RS15470 NADPH-dependent FMN reductase (Variovorax sp. OAS795)
MSVLLIAGSPSAPSRSTALLEAVAERLAGRSAQIERLAIRDLPPAALLLADWNHPAIQRA
IAQVAHARVVVVATPVYKAAYSGVLKVFLDLLAQNALKGKTVLPLATGGSPHHMLALDYA
LRPVLHALSARHILPGVYATDSQITLTPENAYQVHADLAERLNEAVEVLATEGLKLPATH
GFEPVPFSRVRCSV