Protein Info for ABID97_RS14965 in Variovorax sp. OAS795

Annotation: DegQ family serine endoprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02037: peptidase Do" amino acids 53 to 484 (432 residues), 483.1 bits, see alignment E=4.2e-149 PF13365: Trypsin_2" amino acids 120 to 253 (134 residues), 131.7 bits, see alignment E=1.3e-41 PF00089: Trypsin" amino acids 120 to 274 (155 residues), 65.8 bits, see alignment E=1.8e-21 PF00595: PDZ" amino acids 289 to 370 (82 residues), 42.6 bits, see alignment E=2.2e-14 amino acids 400 to 476 (77 residues), 29.3 bits, see alignment E=3.3e-10 PF13180: PDZ_2" amino acids 293 to 381 (89 residues), 56.1 bits, see alignment E=1.3e-18 PF17820: PDZ_6" amino acids 319 to 372 (54 residues), 42.4 bits, see alignment 1.6e-14 amino acids 433 to 477 (45 residues), 40.1 bits, see alignment 8.5e-14

Best Hits

Swiss-Prot: 48% identical to DEGPL_PSEPW: Probable periplasmic serine endoprotease DegP-like (PputW619_1070) from Pseudomonas putida (strain W619)

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 96% identity to vap:Vapar_2386)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>ABID97_RS14965 DegQ family serine endoprotease (Variovorax sp. OAS795)
MNTRLTSPHALVAALATAGVIGAVGAGAYTSARAVNAPTNAASVAPAMVTLPDFSTITSR
DGPAVVNISVTGTAKASDAEAAAEMQGIDPDDPMFQFFRRFQGQAGPRAQQRDVPVRAQG
SGFIVSPDGIIMTNAHVVKDAKEVTVKLTDRREYRAKVLGADAKTDIAVLKIDARNLPTL
ALGNTKDLKVGEWVLAIGSPFGFENTVTAGVVSAKGRSLPDDSYVPFIQTDVAVNPGNSG
GPLLNTRGEVVGINSQIYSRSGGYQGVSFAIPIDVAVQVKDQIVATGKATHARLGVAVQE
VNQAFADSFKLDKPEGALVSNIEKGGPGDKAGLKAGDVIRKVDDQPIVSSGDLPAVIGQQ
APGKKVTLEVWRQGERQALSARLGDASDKPTQVAKNESAAGQGKLGLALRPLQPQEKREA
AIENGLLIEDVAGPSAMAGVQAGDVLLAINGTPAKSLEQVREVVARADKSVALLIQRGED
KIFVPVRIG