Protein Info for ABID97_RS14945 in Variovorax sp. OAS795

Annotation: 4-hydroxybenzoate 3-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02360: 4-hydroxybenzoate 3-monooxygenase" amino acids 1 to 390 (390 residues), 673.3 bits, see alignment E=4.9e-207 PF01494: FAD_binding_3" amino acids 2 to 343 (342 residues), 341.7 bits, see alignment E=2.8e-106

Best Hits

Swiss-Prot: 68% identical to PHHY_PSEAE: p-hydroxybenzoate hydroxylase (pobA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00481, p-hydroxybenzoate 3-monooxygenase [EC: 1.14.13.2] (inferred from 97% identity to vpe:Varpa_2566)

MetaCyc: 68% identical to p-hydroxybenzoate hydroxylase (Pseudomonas fluorescens)
4-hydroxybenzoate 3-monooxygenase. [EC: 1.14.13.2]

Predicted SEED Role

"P-hydroxybenzoate hydroxylase (EC 1.14.13.2)" in subsystem p-Hydroxybenzoate degradation (EC 1.14.13.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.2

Use Curated BLAST to search for 1.14.13.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>ABID97_RS14945 4-hydroxybenzoate 3-monooxygenase (Variovorax sp. OAS795)
MRTQVAIIGAGPAGLLLGQLLFKAGIDNVIVERQSGDYVLGRIRAGVLEQVTMDLLARAG
VDTRAKAEGLPHEGIELLFKGARHRIDMHGLTGGKQVTVYGQTEVTRDLMEARAAEGLTT
IYSAANVSLHDFDSARPRVRYEKDGQAHEIECDFIAGCDGYHGVSRASVPEGAIQTYEKI
YPFGWLGVLADVPPVSHELIYANTERGFALCSMRSATRSRYYVQVPTGERVENWSDEAFW
NELRARLDPEARERLVTGPSLEKSIAPLRSFVAEPMRFGSLFLAGDAAHIVPPTGAKGLN
LATADVGYLSRAFEIFYGEKSPSALDRYSDLCLRRVWKAERFSWWFTSLMHRFPETGAFG
QKIQEAELDYLVHSQAASTALAENYVGLPLEDF