Protein Info for ABID97_RS14925 in Variovorax sp. OAS795

Annotation: arginyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 92% identical to BPT_VARPS: Aspartate/glutamate leucyltransferase (bpt) from Variovorax paradoxus (strain S110)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 92% identity to vap:Vapar_2377)

Predicted SEED Role

"Arginine-tRNA-protein transferase (EC 2.3.2.8)" in subsystem Protein degradation (EC 2.3.2.8)

MetaCyc Pathways

Arg/N-end rule pathway (eukaryotic) (8/14 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>ABID97_RS14925 arginyltransferase (Variovorax sp. OAS795)
MTHLKDLPLHTLQFYATAPYPCSYLPDRQARSQVATPSHLIHNDAYSDLVLSGFRRSGMF
TYRPYCDGCRACIPLRVLVNGFRPSRSQRRAVKQHKELQARVLKLCFVPEHYQLYLRYQN
GRHAGGGMDHDSIDQYTQFLLQSRVNSRLVEFRETLPDGSAGALRMVSILDVLNDGISAV
YTFYEPEPEGRAGYGTYSVLWQIEQARKLGLPHVYLGYWIEGSAKMNYKARFSPHELLVD
GRWQAPDDFTR