Protein Info for ABID97_RS14730 in Variovorax sp. OAS795

Annotation: hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 4 to 258 (255 residues), 331.2 bits, see alignment E=1.8e-103 PF00753: Lactamase_B" amino acids 13 to 169 (157 residues), 69.7 bits, see alignment E=3.4e-23 PF16123: HAGH_C" amino acids 170 to 258 (89 residues), 93.2 bits, see alignment E=1.1e-30

Best Hits

Swiss-Prot: 68% identical to GLO2_RHOFT: Hydroxyacylglutathione hydrolase (gloB) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 91% identity to vap:Vapar_2338)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>ABID97_RS14730 hydroxyacylglutathione hydrolase (Variovorax sp. OAS795)
MTLVPLPAFADNYIWMLQDGSNAIVVDPGDAQPVFDALARDKLQLAAILVTHHHPDHTGG
VAALHAATGAPVFGPARERIPEPFTPLLHGDSADVLGRRFAVIDVPGHTAGHIAYFLAAS
QGQAPLLFCGDTLFSGGCGRLFEGTPAQMLASLDALAALPGDTRVCCAHEYTLANLRFAM
AVEPGNAELTQYTARCENLRREGLPTLPSHIATERRINPFLRSREASVLRAVREHAGLSA
DRAEADVFAALRQWKNDFR