Protein Info for ABID97_RS14630 in Variovorax sp. OAS795

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 41 to 68 (28 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 182 to 208 (27 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 346 to 369 (24 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details amino acids 417 to 439 (23 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 16 to 408 (393 residues), 223.6 bits, see alignment E=2e-70 PF01554: MatE" amino acids 17 to 172 (156 residues), 67.4 bits, see alignment E=6.2e-23 amino acids 242 to 394 (153 residues), 80.2 bits, see alignment E=7.5e-27

Best Hits

Swiss-Prot: 32% identical to NORM_VIBCH: Multidrug resistance protein NorM (norM) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 92% identity to vap:Vapar_2318)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>ABID97_RS14630 MATE family efflux transporter (Variovorax sp. OAS795)
MTGERGLIARHAGTVLVGQLAVMAFGVTDTIVAGRYAESALAALSVGAAIFISVFVSLMG
VLQALLPVWAELHGADRRSEVGRSVRQSLYLSGITIAIGMAVLLFPGAVLRWTQVPPDMR
AGVEAYLAVLAFALPPALLFRLFSTLNQGLGKPQVVTSLQLGSLAVKLPLSIWFTFGGAG
LPAMGLVGCAWATLCVNWTMLACAVWLLRSSAFYRDYRLWERIEAPDWRQIRQFASLGIP
GGLAVLVEVTSFTLMALFIARLGTAAAAAHQIASNLLAVAYMVPLSLGIATSARVSFWLG
AGQAAKARRACRMGFELTALCALFFAGALVALRFQLAHVYSDNPAVIALAAALLLVVAVY
HLADALQTLCVFVLRCYRVTLVPLVIYCTLLWGFGLGGSYLLAYRGLGPWPAMQSPLAFW
LMSTGALAVTALLFGALLRWTMRRSARR