Protein Info for ABID97_RS14580 in Variovorax sp. OAS795

Annotation: histidine phosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00300: His_Phos_1
  • amino acids 3 to 77 (75 residues), 39.3 bits, E=2.9e-14

Best Hits

KEGG orthology group: K08296, phosphohistidine phosphatase [EC: 3.1.3.-] (inferred from 95% identity to vpe:Varpa_2487)

Predicted SEED Role

"Phosphohistidine phosphatase SixA"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Ether lipid metabolism
• Fructose and mannose metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Protein Sequence (153 amino acids)

>ABID97_RS14580 histidine phosphatase family protein (Variovorax sp. OAS795)
MDLIFWRHAEAEDWTEGCDDLQRSLTPRGEKQAKRMAGWLDRQLPDGTRIICSPARRCEQ
TALALGRKYKLRAELAPDTTPEAMLATAGWPNGKSVVLMIGHQPSVGQAISLLLGLKQDS
CPVRKGALWWIRTRERDGDVQTVVVTVQSPELL