Protein Info for ABID97_RS14395 in Variovorax sp. OAS795

Annotation: helix-turn-helix domain-containing GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF12802: MarR_2" amino acids 41 to 100 (60 residues), 40 bits, see alignment E=1.2e-13 PF01047: MarR" amino acids 43 to 100 (58 residues), 39.7 bits, see alignment E=1.2e-13 PF13463: HTH_27" amino acids 46 to 109 (64 residues), 27.4 bits, see alignment E=1.1e-09 PF13673: Acetyltransf_10" amino acids 206 to 300 (95 residues), 37 bits, see alignment E=1.1e-12 PF00583: Acetyltransf_1" amino acids 211 to 294 (84 residues), 51.7 bits, see alignment E=3.6e-17 PF13508: Acetyltransf_7" amino acids 212 to 295 (84 residues), 45.4 bits, see alignment E=3e-15 PF08445: FR47" amino acids 238 to 299 (62 residues), 22.3 bits, see alignment E=3.6e-08

Best Hits

KEGG orthology group: None (inferred from 88% identity to vap:Vapar_2224)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>ABID97_RS14395 helix-turn-helix domain-containing GNAT family N-acetyltransferase (Variovorax sp. OAS795)
MTTATIPAHTATPDPAAVKAIRRFNRFYTSRIGMLDPYLGSDLSLTDVRVLYELAHRQTP
VASEIGRDLRLDAGYLSRILRRFEAEGWLTREPHGRDGRQSVLRLTEAGHAAFAPLQQKS
RDEAAALLSPLPPADRQQVVDAMARIERLLDPASAPARTRTIVLRDPLPGDMGWVVQQHG
ELYAREYGWNGEFEALVADIVAGFVRKFQPEWEKCWIAELDGERVGAIFVVRKSAATAQL
RLLLLAPAARGMGLGARLTDECIAFARNKGYRKMVLWTNSCLEAARAIYAKRGFRLDKAE
PYEGFGKQLVGETWSLKLR