Protein Info for ABID97_RS14310 in Variovorax sp. OAS795

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 29 to 175 (147 residues), 117.4 bits, E=7.8e-38

Best Hits

Swiss-Prot: 54% identical to LOLD_CHRVO: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K02003, (no description) (inferred from 99% identity to vap:Vapar_2206)

MetaCyc: 43% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Protein Sequence (240 amino acids)

>ABID97_RS14310 ATP-binding cassette domain-containing protein (Variovorax sp. OAS795)
MSQPPSDAIVAVEHVFKSVTDSTGTLDILQDIDFTLGARETAAIVGASGSGKSTLLSIIA
GLDTPTRGTVRLAGDDIFAIDEDERAALRAQRVGFVFQSFQLLGNLSALENVMLPLELAD
RKDARKAATEMLGRVGLGQRLGHYPKVLSGGEQQRVALARAFVVQPALLLADEPTGSLDF
ATGEQVMRLMFDLNRELGTTLVLVTHDRGIAAQCERRITIEAGRMALNESKPVLVASLQA