Protein Info for ABID97_RS14265 in Variovorax sp. OAS795

Annotation: protease modulator HflC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01145: Band_7" amino acids 24 to 200 (177 residues), 93.6 bits, see alignment E=7.6e-31 TIGR01932: HflC protein" amino acids 159 to 287 (129 residues), 145.5 bits, see alignment E=8e-47

Best Hits

Swiss-Prot: 39% identical to HFLC_HAEIN: Protein HflC (hflC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04087, membrane protease subunit HflC [EC: 3.4.-.-] (inferred from 95% identity to vap:Vapar_2195)

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>ABID97_RS14265 protease modulator HflC (Variovorax sp. OAS795)
MNRIGFIASSILVLLVLLSSTLFVVDQRQFGVVYSLGQIKDVIIEPGLNFKLPPPFQNVS
YIDKRLLTLSSIDTEPMLTAEKQRVVIDWYVRWRISDPRAYIRNVGLDENAGAMQLNRVV
RNAFQENINKRTVRDLISVRREALMADVQREVLAVVKGAKPWGVDVVDVRITRVDYVEAI
TESVYRRMEAERKRVANELRSTGYAEGEKIRADADRQREVIVANAYRDAQKIKGEGDAQA
ASAYSEAFGRDPQFAQFYRSLEAYKQSFNKKSDVMVVDPSSDFFRAMQGAGTPAGNAPRR