Protein Info for ABID97_RS14095 in Variovorax sp. OAS795

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 847 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 332 to 455 (124 residues), 89.4 bits, see alignment E=1e-29 PF13188: PAS_8" amino acids 333 to 382 (50 residues), 31.3 bits, see alignment 4.8e-11 PF00989: PAS" amino acids 333 to 445 (113 residues), 65.2 bits, see alignment E=1.9e-21 PF08448: PAS_4" amino acids 346 to 448 (103 residues), 35.8 bits, see alignment E=3e-12 PF13426: PAS_9" amino acids 347 to 447 (101 residues), 47.2 bits, see alignment E=8.1e-16 PF00512: HisKA" amino acids 602 to 669 (68 residues), 33.8 bits, see alignment E=1e-11 PF02518: HATPase_c" amino acids 714 to 831 (118 residues), 62.2 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: None (inferred from 98% identity to vap:Vapar_2161)

Predicted SEED Role

"Probable two-component transmembrane sensor histidine kinase transcription regulator protein (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (847 amino acids)

>ABID97_RS14095 PAS domain S-box protein (Variovorax sp. OAS795)
MPFSSPLAVARSAVNASPLSWWRRWWRRQTPVLQDAVAMLAPLAAVLLFLAAIVSAFWYL
RTEEVEREQESVRRDVEYAQQRMRLRLLERQEQLMRIARDASNREIDPVEFASRAESLVS
QFPELQTVTWIDDRRRFKAGYSAPSVHPSQQHLIGDVLRPGDIESNYALARELRQPVFSQ
PMAGGDPSAMLQLHIPLFDQGLFAGVVLGEFSVDGLLRYAMPSEVQARYAVSLLDAKGNV
IAGNTTASNRESGTRLLPWSERTNEYEVPVSPVGNALVLRAQAYRTSQGVVGNGLFWLVC
ALSVLTSWMLIGTWRHTRRRQQAQQRLVAETNFRRAMENSMLTGMRVLDLQGRITYVNAA
FCAMTGWSEAELVGQSPPFPYWLESDREVMNERLEEELHGRALPGGFQVRVKRKNGSVFN
ARLYVSPLIDARGHQTGWMTSMTDITEPTRIREQLSASYERFTTVLEALDAAVSVAPIGS
EELLFANKLYRLWFGSDTVGHLGMVAQAGVPTSNAHDEGLDDVDPYAGLPIDTLTAAQAA
NNEIFVPHLGKWLEVRSRYLTWVDGRLAQLVIATDITPRRDAEEQAAAQADRAQAASRLI
TMGEMASSVAHELNQPLTAITNYCNGMMSRIKGQAIDSDALLAALEKTSKQAQRAGQIIQ
RIRSFVKRSEPNRTAADVATMVSEAVELAGIELRRRNVRLNHYVAARLPVVQVDPILIEQ
VMVNLLKNAAEAIDIAERPLARRSVELRVLPKVIEGHNAIEFSVQDTGKGLAPEVMDRLY
EAFFSTKPEGMGIGLNLCRTIVESHRGRMQAENIYNGPDVIGCRFSFWIPVLDAPSSVAS
DEAKVPA