Protein Info for ABID97_RS14070 in Variovorax sp. OAS795

Annotation: ribose-5-phosphate isomerase RpiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR00021: ribose 5-phosphate isomerase A" amino acids 25 to 236 (212 residues), 217.8 bits, see alignment E=6e-69 PF06026: Rib_5-P_isom_A" amino acids 67 to 235 (169 residues), 193.4 bits, see alignment E=1.2e-61

Best Hits

Swiss-Prot: 77% identical to RPIA_POLSJ: Ribose-5-phosphate isomerase A (rpiA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 92% identity to vap:Vapar_2156)

MetaCyc: 61% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>ABID97_RS14070 ribose-5-phosphate isomerase RpiA (Variovorax sp. OAS795)
MTAPVSPSSVPGDGATGAISKDELKAQVGRAALAYVAKGEIVGVGTGSTVNKFIDALATI
KDQIKGAVSSSVASTERLRALGIPVFDSNEVEELGVYIDGADEIDHHGFMVKGGGAALTR
EKIVAAQSRRFVCIADASKLVDVLGAFPLPVEVIPMAARRVMRQFEAMGGIAQVREKDGL
PLVTDNGQHIVDVTGLRISDPLAFESEVSQWPGVVTVGVFAHQKAHVCLLGTASGVQTLR
FD