Protein Info for ABID97_RS13975 in Variovorax sp. OAS795

Annotation: LysE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 205 (191 residues), 119 bits, see alignment E=9.5e-39

Best Hits

Swiss-Prot: 34% identical to Y136_VIBCH: Uncharacterized membrane protein VC_0136 (VC_0136) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 93% identity to vpe:Varpa_3755)

Predicted SEED Role

"putative amino acid efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>ABID97_RS13975 LysE family transporter (Variovorax sp. OAS795)
MTLDTLLIYVVASLALAVIPGPTMLLALSNGIDGGMRRASWGIAGASLGSVTLIAVVALG
LGSLLAASELLFNAIRVAGVAYLVWLGVKLWRSEATDLGTALASSAIEHRPHGRVALVRS
LLVALSNPKTVLFFAAFLPQFIDISQPQGTQYLLLGSIFVALDTCVMLAYAAAGTQAVRW
LSRRGLKALNRSCAAGMWLLAATLAFWRRPGT