Protein Info for ABID97_RS13655 in Variovorax sp. OAS795

Annotation: hydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF07449: HyaE" amino acids 28 to 133 (106 residues), 113.1 bits, see alignment E=3.3e-37

Best Hits

Swiss-Prot: 56% identical to HOXO_CUPNH: Hydrogenase expression/formation protein HoxO (hoxO) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03619, hydrogenase-1 operon protein HyaE (inferred from 67% identity to pna:Pnap_1969)

Predicted SEED Role

"Hydrogenase maturation factor HoxO/HyaE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>ABID97_RS13655 hydrogenase (Variovorax sp. OAS795)
MTLETTGTETLVRLPVQQPEPRREGSALIARLVEGFGATWVDDQSIDAWSALGGDRVVLF
AGDPVRFPEGQDVAAVLPELMRSFPGRFAVAVVPRDLEDKVARRFGSQRWPTLLFLRDGG
YVGTVSGMHDWDVFVQRVESALASPVGRAPTIGIPVVSATGAADACH