Protein Info for ABID97_RS13515 in Variovorax sp. OAS795

Annotation: MMPL family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 802 transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 368 to 393 (26 residues), see Phobius details amino acids 428 to 450 (23 residues), see Phobius details amino acids 472 to 490 (19 residues), see Phobius details amino acids 631 to 648 (18 residues), see Phobius details amino acids 654 to 675 (22 residues), see Phobius details amino acids 683 to 706 (24 residues), see Phobius details amino acids 722 to 745 (24 residues), see Phobius details amino acids 756 to 781 (26 residues), see Phobius details PF03176: MMPL" amino acids 587 to 779 (193 residues), 48.4 bits, see alignment E=3.5e-17

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 74% identity to bge:BC1002_4176)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (802 amino acids)

>ABID97_RS13515 MMPL family transporter (Variovorax sp. OAS795)
MHPSKGSESDSALQLNPASGSFLERAIFNHRRVIMCLCALITLVLGWQATRLQLNASFEK
TIPVHHPYVQNYLKHQTDLSGLGNAVRIAVANPGGTIYESAYLDALRRLSDEVFLIPGVA
RNQMKSLWTPTTRWVGVTEDGLEGGPVIPDGYDGSATSLANLQSNIARSGEIGQLVALDA
RSSVIYVPLLAKGSDGRPLDYTQLATRLEELRTKYETQGLTLHIVGFAKIVGDLIEGVRS
VVLFFGFAVVIAAGMVFWYTRCLRSTALVLVASLTAVVWELGLLPTLGFALDPYSILVPF
LVFAIGMSHGAQKMNGIMQDVGRGMHKLVAARLTFRRLFLAGLTALLADVVGFAVLLVID
IQSIRELAIAASLGVGALIFTNLILLPVLLSYTGVSAKAAERSLRSQQPGTAKHPVWAVL
DLFTHKRYASLAVIAGLIMAVAGMFASTHLKIGDLDPGAPELRSHSRYNRDVAFMNAAYG
ASSDVLAVMVKVPDGQCSKFETLNKVDALEWELRQLEGVESTNTLALLNRRVLTGLNEGN
PKWFEFLSNQDMLNTVTAGAPRGLYNEACNLLTMYVFLRDHRADTLTRVREHVEQFAREN
DTTDVRFLLAAGNAGIEATTNIVVKDAWRQMLFLVYGAVIVLCFVTFRSWRAVVVAVLPL
VLTSFLAEALMVALGMGIKVATLPVIALGVGIGVDYALYILSVTLAQLRDGKSLSEAYHQ
SLLFTGKVVMLTGFTLAVGVITWVASPIKFQADMGVLLAFMFLWNMLGALVLLPALAYFL
LPTGTKYPSTAAALRPAENPSL