Protein Info for ABID97_RS13295 in Variovorax sp. OAS795

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 304 to 320 (17 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 81 to 147 (67 residues), 56.3 bits, see alignment E=1.8e-19 PF00528: BPD_transp_1" amino acids 220 to 385 (166 residues), 61.3 bits, see alignment E=5.4e-21

Best Hits

Swiss-Prot: 49% identical to YHDX_ECOLI: Putative amino-acid ABC transporter permease protein YhdX (yhdX) from Escherichia coli (strain K12)

KEGG orthology group: K09970, general L-amino acid transport system permease protein (inferred from 63% identity to put:PT7_2385)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>ABID97_RS13295 amino acid ABC transporter permease (Variovorax sp. OAS795)
MSSHHRAPLKFSWNNPEFRALAYQFVVVGLAALLAYYLVSNTLHNLATRNIATGFAFLER
EAGFAIGESLIEYSPSDTYARAILVGLANTLRVSAVALVLATMLGVIVGIARLSSNWLVA
RLASAYVELIRNVPLLLQLLIWYAVIGELLPGPKAAFHPLPGIYLSNRGMLMPSVDGPAV
TGILWGLVLAAIAIFAVSRWQRARRRQTGVPARLWPIALTFLLLMPTVGWLLGGREFHLS
IPHRSGFNFEGGWALSPELFALLVGLVTYTAGFIAEIVRAGVQSVSHGQWEAAQTLGLPR
SRVLRLVILPQALRVIVPPTTSQYLNLVKNSSLAVAIGYPDLVSVVNTVLNQTGQAIEGV
LIIMAAFMTVSLTVSLLMNWYNKRIALVER