Protein Info for ABID97_RS13190 in Variovorax sp. OAS795

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 30 to 369 (340 residues), 220.6 bits, see alignment E=7.5e-69 PF13433: Peripla_BP_5" amino acids 30 to 372 (343 residues), 99 bits, see alignment E=4.8e-32 PF01094: ANF_receptor" amino acids 53 to 343 (291 residues), 33.9 bits, see alignment E=2.8e-12

Best Hits

Swiss-Prot: 54% identical to LIVB6_BRUME: Leu/Ile/Val-binding protein homolog 6 (BMEII0633) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 56% identity to rec:RHECIAT_CH0003683)

Predicted SEED Role

"Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>ABID97_RS13190 ABC transporter substrate-binding protein (Variovorax sp. OAS795)
MKFNRRAIACALFASAALAFASPGAMAQAVKVGIIGPFSGPFAHYGSLFKAAAESYVASQ
GGKLAGKDVEFIYRDTGGPNPALTKTLVQELLVKDKVDYLGGFVFTPNAMAVAPLIQQSR
TPTVIFNAATSAITEKSEYFLRSSYTLWQVTVPAAQWAAKQGVKKVVTAVTDFGPGIDAE
TAFKSEFAKQGGTVVESIRMPIATTDFGPFVQRIKASGAQAVYTFLPGGPPNLGFVKAYN
ENGLAKAGVQFLGSAETDEYDLQKFGDSAVGLTTAFHYSGAHDSPENKKFIAALKKQDPN
AVANYASVGAWDGMYLIHKMIEATGGQKDGPKALAAARTLKWESPRGPVSIDPRTRHITQ
NVYLRKVEKVGDQLVNKEIQSFGLQTDFGLEK