Protein Info for ABID97_RS13010 in Variovorax sp. OAS795

Annotation: DotU family type IV/VI secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 189 to 212 (24 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 2 to 216 (215 residues), 111.2 bits, see alignment E=3.1e-36 PF09850: DotU" amino acids 3 to 208 (206 residues), 125.8 bits, see alignment E=9.1e-41

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>ABID97_RS13010 DotU family type IV/VI secretion system protein (Variovorax sp. OAS795)
MRLVDCFIPALAVVRQFADAPADDAPVLAARLQPLLATAQHDGLALGASEEDVRSALFAV
SAWVDEALLTCNWPAAEAWQRLLLQRQFFGVSNAGVAFFQRLAELGDGRADVAEVYVLCL
SLGFKGRFGHGGDARELADIRLRAMRRVLAHASANGVSEAETLVFPGAKPAEPARGAAVR
RSRWMPSRLSVAVLSISVLTLLVLYLVFFSILRQQVHAILPLIR