Protein Info for ABID97_RS12950 in Variovorax sp. OAS795

Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 886 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 14 to 869 (856 residues), 1171.1 bits, see alignment E=0 PF02861: Clp_N" amino acids 26 to 75 (50 residues), 26.7 bits, see alignment 2.1e-09 PF00004: AAA" amino acids 226 to 337 (112 residues), 38.6 bits, see alignment E=5.5e-13 amino acids 619 to 739 (121 residues), 27.1 bits, see alignment E=2.1e-09 PF17871: AAA_lid_9" amino acids 365 to 460 (96 residues), 111.2 bits, see alignment E=9e-36 PF07724: AAA_2" amino acids 614 to 779 (166 residues), 180.1 bits, see alignment E=1.4e-56 PF07728: AAA_5" amino acids 618 to 740 (123 residues), 37 bits, see alignment E=1.3e-12 PF10431: ClpB_D2-small" amino acids 785 to 857 (73 residues), 48.2 bits, see alignment E=3.7e-16

Best Hits

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (886 amino acids)

>ABID97_RS12950 type VI secretion system ATPase TssH (Variovorax sp. OAS795)
MLLVDLKPLVGRLDGYCKESLENAVGLCVSRGHYEITVEHLLHRLLDEPQADLPLLLRQN
GVEAVVLRQGVDRVLEDMRTGNAGRPAFSPLLLELLQDAWLLGSVDLGQSLIRSGAVLVA
LVARASFYAGGSIGPLLSPLVKETLLSQFPTVCAGSIEGHPAAALGGGGGEGAQAGGAPG
GAIAKYCENFTGKARSGKIDPVFGRDAEIRQMVDILARRRKNNPICVGDPGVGKTAVVEG
LALRIVEGDVPDMLKDVTLLGLDMGMLQAGASVKGEFENRLKGVIEEVKASATPIILFID
EAHTLIGAGGQAGTSDAANLLKPALARGELRTIAATTWAEYKKYFEKDAALARRFQLVKL
DEPDVATAVQILRGLRDRYQEVHQVAIRDDAIVAAAELSSRYISGRQLPDKAVDLLDTAC
ARVKVLKNAKPDLLEDTERRMQALEREKRGLRQDVDNRQAIEPQRFTDIDTLLDTLATQA
DDLRARWQAQRDAAQVLLEARGAYGTARGEAGANAGSPALMALEDTLLQAERAFAEAQGS
EALVRIDVDPDVVAKVVSDWTGVPVGKMQRDQASTALGLADALKRRIRGQDAALDQVAEI
VKTASSGLNDPRQPLGVFLLVGPSGVGKTETALAVADLLFGDEKSTVVVNMSEFQERHNV
SRLIGSPPGYVGYGEGGLLTEAVRQRPYSVVLLDEVEKAHLDVLNLFYQVFDKGMLSDGE
GKEIDFANTVIFLTSNLATDVITEMTQGGEKPDAAVLAGAIRPLLSNHFKPALLARMTIV
PYVTLDAQALGGIVRLKLDRIVQRLARNNKMRFTYAEAVVERIAARCTEVETGARNIDFI
LRGNVLPLMSQQILQRMGSGEPAAVVHLDVDAQGEFAVSFAGDATP