Protein Info for ABID97_RS12940 in Variovorax sp. OAS795

Annotation: type VI secretion system baseplate subunit TssF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 transmembrane" amino acids 459 to 473 (15 residues), see Phobius details amino acids 531 to 545 (15 residues), see Phobius details PF05947: T6SS_TssF" amino acids 4 to 584 (581 residues), 487.1 bits, see alignment E=4.3e-150 TIGR03359: type VI secretion protein, TIGR03359 family" amino acids 6 to 587 (582 residues), 535.9 bits, see alignment E=8.4e-165

Best Hits

Predicted SEED Role

"Protein ImpG/VasA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (587 amino acids)

>ABID97_RS12940 type VI secretion system baseplate subunit TssF (Variovorax sp. OAS795)
MSKANFLRYYQDQLQQLRELSVEFARGNPALAPMLAEPSSDPDVERLLEGVAFLNGLTRQ
KLDDEFPELLQELATQLFPHYLRPVPASTLVAFEPKGMLSEPMHVPAGVELASLPIDGTR
CRFRTSHALQVEPLALRGFELVQHAGRAPALRMDFGLQGIDLSQWQAASVRLFLGAGYAE
ASNLLMLLMTKVAQVEVVAGGPQQSGARFALGPQALRCAGFDHEMLAYPEHAFPGFRIIQ
EYFALPEKLLFVELGGLDRWRTGRSGMQFSVWLTLTDLPEWAPELREHSLLLNVVPALNL
FQHAAEPIQNEHLTSEYRVRPENEKKGHYQIFSVDRVCGYTQGESEERFYTPFGMAALPV
RTGQAAREQASYSLSRRAATVGRGQDLFLSIATPRQQALKSETLSITLTCTNAELPESLK
LGDISQPTSSSPERLGFRNIRAVTPQLNPPADEHLLWRMISHISLNFLSLADAANLKMML
DLYVFSERQDHGREIANRHRIAGIESLEAEPETRLIGRRMLSGQRLRLLCRSSHFASLGG
LYVFGCVIERFLGDYAAINAYTRLELKDADTGAVFEWPARLGRQCLL