Protein Info for ABID97_RS12880 in Variovorax sp. OAS795

Annotation: phosphoribulokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00485: PRK
  • amino acids 7 to 214 (208 residues), 231.4 bits, E=4.3e-73

Best Hits

Swiss-Prot: 76% identical to KPPR2_CUPNH: Phosphoribulokinase, chromosomal (cfxP) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00855, phosphoribulokinase [EC: 2.7.1.19] (inferred from 98% identity to vap:Vapar_3025)

Predicted SEED Role

"Phosphoribulokinase (EC 2.7.1.19)" in subsystem Calvin-Benson cycle (EC 2.7.1.19)

MetaCyc Pathways

• Rubisco shunt (10/10 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• oxygenic photosynthesis (12/17 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.19

Protein Sequence (292 amino acids)

>ABID97_RS12880 phosphoribulokinase (Variovorax sp. OAS795)
MSAKHPIVAITGSSGAGTTSVTRTFENIFRRESVKAAIVEGDSFHRYDRTTMKVAMAEAE
SAGNRNFSHFGEDANLFAELEALFRDYGEAGVGQSRKYLHDATEAAPYKQEPGTFTPWET
LPDSELLFYEGLHGGVTTEKVDIARHVDLLIGVVPVINLEWIQKLHRDKNTRGYSTEAVT
DVILRRMNEYVHYICPQFTRTHINFQRVPVVDTSDPFIARTIPSPDESLVVIRFANPAGF
DFPYLLSMLHDSFMSRANTLVVPGGKMELAMQLIFTPMILRLMERRKKSYAI