Protein Info for ABID97_RS12865 in Variovorax sp. OAS795

Annotation: ribulose-phosphate 3-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00834: Ribul_P_3_epim
  • amino acids 10 to 206 (197 residues), 297.5 bits, E=1.9e-93
• TIGR01163: ribulose-phosphate 3-epimerase
  • amino acids 10 to 219 (210 residues), 304.6 bits, E=1.5e-95

Best Hits

Swiss-Prot: 69% identical to RPEC_CUPNH: Ribulose-phosphate 3-epimerase, chromosomal (cbbEC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 91% identity to vap:Vapar_3028)

MetaCyc: 67% identical to ribulose-phosphate 3-epimerase (Escherichia coli K-12 substr. MG1655)
Ribulose-phosphate 3-epimerase. [EC: 5.1.3.1]

Predicted SEED Role

"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)

MetaCyc Pathways

• Bifidobacterium shunt (14/15 steps found)
• Rubisco shunt (10/10 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• pentose phosphate pathway (8/8 steps found)
• heterolactic fermentation (15/18 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• oxygenic photosynthesis (12/17 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.1

Use Curated BLAST to search for 5.1.3.1

Protein Sequence (234 amino acids)

>ABID97_RS12865 ribulose-phosphate 3-epimerase (Variovorax sp. OAS795)
MQKNNETLRIAPSLLSADFARLGEEVTAVIQAGADLIHFDVMDNHYVPNLTIGPLVCEAI
KPYATVPIDVHLMVKPVDALIPMFAEAGASIISFHPEASEHIDRTIRLIAASGCKAGLVL
NPATPLQVLDHVLDQLDLVLLMSVNPGFGGQSFIESVLPKIEAVRRRIDATGRDIWLEVD
GGVKPGNAARIGAAGADTLVAGSAVFSGGRYREAIDAIRTQALQGRRDMEGRPA