Protein Info for ABID97_RS12840 in Variovorax sp. OAS795

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00126: HTH_1" amino acids 9 to 68 (60 residues), 80.4 bits, see alignment E=1.1e-26 PF03466: LysR_substrate" amino acids 94 to 297 (204 residues), 170 bits, see alignment E=7.1e-54 PF12849: PBP_like_2" amino acids 101 to 247 (147 residues), 27.5 bits, see alignment E=3.8e-10

Best Hits

Swiss-Prot: 39% identical to CMPR_SYNY3: HTH-type transcriptional activator CmpR (cmpR) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_3033)

Predicted SEED Role

"LysR family transcriptional regulator YeiE" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>ABID97_RS12840 LysR family transcriptional regulator (Variovorax sp. OAS795)
MPLTKHASFRQLAAFHAVARLGSVSLAADEMHLTQPAVSIQIGTLEESAGTPLLQRTGRG
IRLTEAGELLAGYAGRILDLWREAGDEMAMLQGVFSGTLRVGAITTAEYLLPPILVNFAK
EHPKVKVKLQVGNRDEIVRMLAGQEIDIAIMGRPPAELKTDSSAFAKHPMAFLAAPSHPL
MSAARPTLAMLSDTRMLVRERGSGTRTTVERFFKDQGLPLRIGSELSSNEAIKQMCAAGF
GIAFLSMHTCVLEMNAGLLGVLPVPGNPVVRDWYVMHLASRQLPQVALAFEDYLRTHGQA
QIQHQLGTLPAARPAAKKRGARRAA