Protein Info for ABID97_RS12705 in Variovorax sp. OAS795

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 54 to 71 (18 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details PF00672: HAMP" amino acids 164 to 216 (53 residues), 32 bits, see alignment 2e-11 PF07730: HisKA_3" amino acids 248 to 313 (66 residues), 40.9 bits, see alignment E=3.7e-14 PF02518: HATPase_c" amino acids 360 to 452 (93 residues), 34.3 bits, see alignment E=4.3e-12

Best Hits

KEGG orthology group: K07675, two-component system, NarL family, sensor histidine kinase UhpB [EC: 2.7.13.3] (inferred from 92% identity to vap:Vapar_3059)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>ABID97_RS12705 histidine kinase (Variovorax sp. OAS795)
MTLRLKINLIVSLLTMLFVTAMLALQLRAMRESVHEEVVAANRVAAQLLNRTAWLYAAQG
TPAMLSFLQGVGRVRSNDIMLLDSDDKVLYSSPTSVYKAGRDAPDWFASLVSPPPSKLSI
AFPGGQLVVHSNASRAVLDAWDDFVLLTLSALGLLAVVNAGVFWLVGRATRPFGDIVDAL
NQLESGRFDVALRALPGTEAAAIGAAFNRMVGMLQQHIETERRAVRAESRLSESRELGRW
VDQKIEQERRLIARELHDELGQSVTAMRSMALSIAQRVQSLDPQAEQAARLIAEESGRLY
TAMHGMIPRLTPLVLDKFGLVAALEDLVERTRNSHGEVEVEWHLAIELDRLRLDTDTALV
LYRAAQEGITNALRHGEARRIVLALEGDEHTVDLTLTDDGRGLPGPEAARETSVGHYGLR
WLAERIDSLGGELRLEPAAPSGARLKVRLPLPAAATENA