Protein Info for ABID97_RS12540 in Variovorax sp. OAS795

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF13404: HTH_AsnC-type" amino acids 16 to 56 (41 residues), 50.8 bits, see alignment E=2.4e-17 PF13412: HTH_24" amino acids 16 to 62 (47 residues), 54.2 bits, see alignment E=1.7e-18 PF01037: AsnC_trans_reg" amino acids 81 to 154 (74 residues), 83.3 bits, see alignment E=1.8e-27

Best Hits

Swiss-Prot: 37% identical to LRP_SHIFL: Leucine-responsive regulatory protein (lrp) from Shigella flexneri

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 99% identity to vap:Vapar_2047)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>ABID97_RS12540 Lrp/AsnC family transcriptional regulator (Variovorax sp. OAS795)
MKNLRKTPSNGEGSFDKIDMAILRVLLLDSRKTLQEIGHEVGLSPTSCWTRIKKLEAQGV
IKRYTIDVDPAKLGYHDSVIVQVTLESHTDETLYDFGRVLATIPEIQEAYLVSGDYDYYI
RIAVRDTRDYERLLREKLYKIPGIRHSKSHFVLRVLKETSVPVI