Protein Info for ABID97_RS12520 in Variovorax sp. OAS795

Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 15 to 558 (544 residues), 626.3 bits, see alignment E=2.3e-192 PF00664: ABC_membrane" amino acids 53 to 269 (217 residues), 40.6 bits, see alignment E=2.5e-14 PF00005: ABC_tran" amino acids 349 to 495 (147 residues), 97.4 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 46% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 70% identity to ajs:Ajs_0582)

Predicted SEED Role

"type I secretion system ATPase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (594 amino acids)

>ABID97_RS12520 type I secretion system permease/ATPase (Variovorax sp. OAS795)
MKPQEKPGELRQAVTALRGYFVRAAWFSACSALLLLAPSGYMLEVYGRVVNSRSALTLAM
LTLLVLAAFCLMEVLEWARTEVMYRAGRKLDQKLRNRVFAAIFEAGLKRLPGGTAQPLND
LRTLREFLYSPPLLALMEAPVALVCMGLMFAISPVLGWSAVVGSLLQVFVGWLNDRNTRP
PLVSANRCAIEAQQYADAALRNSQVIESMGMLRDVHRRWMARRREFLQREAVASDSAGSY
QALSKFLQVTTGSLLLGLGAWLLLRNQLNGDAGMMVVGSILGGRALAPLVLLVAQWRMVV
NASDAWQRLDSLLAAIAPRPDTMPLPPPKGALQVESVVAGAPGGGSAILRNVGFALAPGE
VLAVVGPSAAGKTTLARLLVGLWPAASGKVRLDGADVFAWDKTELGPHIGYLPQEVELLE
GTLAENIARFAEVRPGKVRAAAMAVDLHGWIMSLPLGYDTPIGPEGAVLSGGQRQRVALA
RALYGQPALVVLDEPNSSLDDAGDAALAAAILALKARGTTFVVMTHRTSVLAVADKMLVL
CDGAMQGFGARDEVLAALRQAGQQAVDRMRKAANQSVSRQGEAGNAVGVAPAAS