Protein Info for ABID97_RS12460 in Variovorax sp. OAS795

Annotation: acetoacetyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00106: adh_short" amino acids 4 to 196 (193 residues), 213.5 bits, see alignment E=3.1e-67 TIGR01829: acetoacetyl-CoA reductase" amino acids 4 to 244 (241 residues), 379.8 bits, see alignment E=2.9e-118 PF08659: KR" amino acids 8 to 178 (171 residues), 76.7 bits, see alignment E=3.2e-25 PF13561: adh_short_C2" amino acids 14 to 243 (230 residues), 187.1 bits, see alignment E=6.1e-59

Best Hits

Swiss-Prot: 72% identical to PHAB_CUPNH: Acetoacetyl-CoA reductase (phaB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 99% identity to vpe:Varpa_3856)

MetaCyc: 72% identical to hydroxyvaleryl-CoA reductase / acetoacetyl-CoA reductase (Cupriavidus necator)
Acetoacetyl-CoA reductase. [EC: 1.1.1.36]; 1.1.1.36 [EC: 1.1.1.36]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.36

Use Curated BLAST to search for 1.1.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>ABID97_RS12460 acetoacetyl-CoA reductase (Variovorax sp. OAS795)
MSKKVAYVTGGMGGIGTAICQRLHRDGFTVIAGCGPTRDHAKWLAEQKAEGFEFHASVGN
VGDWQSTVEAFSAAKAAHGPIDVLVNNAGITRDRMFLKMTPEDWSAVIETNLNSMFNVTK
QVVGDMVEKGWGRIINISSVNGAKGQAGQTNYSAAKAGMHGFTMALAQELANKGVTVNTV
SPGYIGTDMVKAIRQEVLDKIIATIPVKRLGEPSEIASIISWLATDEGGYSTGADFSVNG
GLHMH