Protein Info for ABID97_RS12365 in Variovorax sp. OAS795

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 37 to 69 (33 residues), 24.6 bits, see alignment (E = 3e-09)
• PF00890: FAD_binding_2
  • amino acids 38 to 77 (40 residues), 28.8 bits, 1.5e-10
• PF01266: DAO
  • amino acids 38 to 393 (356 residues), 254.4 bits, E=4.9e-79
• PF13450: NAD_binding_8
  • amino acids 41 to 80 (40 residues), 25.4 bits, 2.8e-09

Best Hits

Swiss-Prot: 43% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 92% identity to vap:Vapar_2011)

MetaCyc: 43% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]

Predicted SEED Role

"Glycine/D-amino acid oxidase (deaminating) in putrescine utilization cluster"

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (9/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (7/11 steps found)
• superpathway of ornithine degradation (4/8 steps found)
• putrescine degradation II (1/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3

Protein Sequence (437 amino acids)

>ABID97_RS12365 FAD-binding oxidoreductase (Variovorax sp. OAS795)
MLLRKELGVVENSYYEASVERAVRFEAARPLEGIATADVCVVGGGLAGLSAALELALRGF
AVVLLEAQRVGWGASGRNGGQVIVGFGSDGEEAIEDQFSPEDVRRAWNISVEGLDLMQER
IASYAIDCDWQPGYLNLSVKPSKSRALRAWMDHVQRVHGYPLQWLGPREVAERVASERFH
AGTFDARSGHLHPLKYSLGLAGAARAAGAQLHENSAAQVIERGPRPVVKTAQGEVRCSFV
VLAGNVYLAEYGDDVAPEVSSRIMPVGTYMIATEPMGKDRADALMRGRPAASDTNFVLDY
FRLSADHRLLFGSGDSYSARTPRNLIEKIRKSMLAVFPQLSDLGIDHAWGGFVDITMNQA
PDFGRLGTNIYYLQGFSGHGLALTGMAGKLAAEAIAGQAERFDLFARIGHHAFPGGTMLR
TPALVLGMLYYRLRDML