Protein Info for ABID97_RS12330 in Variovorax sp. OAS795

Annotation: isochorismatase family cysteine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 18 to 181 (164 residues), 106.4 bits, E=9.4e-35

Best Hits

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_2002)

Predicted SEED Role

"Nicotinamidase (EC 3.5.1.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 3.5.1.19)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• aldoxime degradation (3/3 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.19

Use Curated BLAST to search for 3.5.1.19

Protein Sequence (198 amino acids)

>ABID97_RS12330 isochorismatase family cysteine hydrolase (Variovorax sp. OAS795)
MAPSQPPVLAPVPAAGRTALLIIDMISCWDFPDAEKLLPGAHAIAGRIKALKARCTRAGV
PTIYVNDNRGRWRSDFPKLVEMSLAAGGAGAEITSALLPEEDDYFVLKPKQSAFFATPLE
LLLAYLKASRLIVTGVASDQCIVATVADAGMRDLEAVVPRDCVASQSRARNERFLRQAEE
ALRVSTTPGPRIRLPARR