Protein Info for ABID97_RS11835 in Variovorax sp. OAS795

Annotation: ZIP family metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 246 to 246 (1 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details PF02535: Zip" amino acids 158 to 296 (139 residues), 47.7 bits, see alignment E=6.8e-17

Best Hits

Swiss-Prot: 50% identical to GUFA_MYXXA: Protein GufA (gufA) from Myxococcus xanthus

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 76% identity to vpe:Varpa_3095)

Predicted SEED Role

"Metal transporter, ZIP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>ABID97_RS11835 ZIP family metal transporter (Variovorax sp. OAS795)
MTTLDLLFARGPRMRPLRRGVGFAIVAVGLGLLAFEAVEAIASGDARVRGALVGGSLAAL
ATALGTIPVLLSQQFSQRIYDSMLGFGAGVMLAATSFSLVIPALQAARLQGAGSWGAGGI
VGAGVLLGAALLLAIDRLVPHEHFVKGLEGPKAMKLKRVWLFVLAIALHNLPEGLAIGVA
FAGSDPVAAGALATGISIQDVPEGMVVALALRGVGYGRLLSVGLGVASGLVEPAMAVLGA
TVVTLMASLLPWGLALAAGAMLFVISHEIIPESHRQGHEAFATGGLMLGFVLMMVLDTAL
G